Skip Navigation

Integrative and Comparative Biology 2003 43(2):313-322; doi:10.1093/icb/43.2.313
© 2003 by The Society for Integrative and Comparative Biology
This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Search for citing articles in:
ISI Web of Science (3)
Right arrow Request Permissions
Google Scholar
Right arrow Articles by Lehrer, R. I.
Right arrow Articles by Waring, A. J.
Right arrow Search for Related Content
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?


Natural Peptide Antibiotics from Tunicates: Structures, Functions and Potential Uses1

Robert I. Lehrer2,1,2, J. Andrew Tincu3, Steven W. Taylor3,4, Lorenzo P. Menzel1 and Alan J. Waring1
1 Department of Medicine
2 Molecular Biology Institute, Department of Medicine, UCLA School of Medicine, 10833 LeConte Avenue, Los Angeles, California 90095
3 Center for Marine Biotechnology and Biomedicine, Scripps Institution of Oceanography, University of California San Diego, La Jolla, California 92093
4 Present Address of Steve W. Taylor is MitoKor corporation, 11494 Sorrento Valley Road, San Diego, California 92121


    SYNOPSIS
 TOP
 SYNOPSIS
 References
 
Because tunicates rely on innate immunity, their hemocytes are important contributors to host defense. Styela clava, a solitary ascidian, have eight hemocyte subtypes. Extracts of their total hemocyte population contained multiple small (2–4 kDa) antimicrobial peptides. When purified, these fell into two distinct families that were named styelins and clavanins.

Styelins A-E are phenylalanine-rich, 32 residue peptides with activity against marine bacteria and human pathogens. They show considerable sequence homology to pleurocidins, antimicrobial peptides of the flounder, Pseudopleuronectes americanus. Styelin D, one of the five styelins identified by peptide isolation and cDNA cloning, was remarkable in containing 12 post-translationally modified residues, including a 6-bromotryptophan, two monohydroxylysines, four 3,4-dihydroxyphenylalanines (DOPA), four dihydroxylysines and one dihydroxyarginine. These modifications enhanced Styelin D's bactericidal ability at acidic pH and high salinity. A novel histochemical stain for DOPA suggested that Styelin D was restricted to granulocytes.

Clavanins A-E are histidine-rich, 23 residue peptides that are C-terminally amidated and most effective at acidic pH. Clavaspirin is a newly described family member that also has potent cytotoxic properties. By immunocytochemistry, clavanins were identified in the granules of five eosinophilic granulocyte subtypes and in macrophage cytoplasm.

Transmission and scanning electron micrographs of methicillin-resistant Staphylococcus aureus (MRSA) and E. coli that had been treated with Styelin D and clavaspirin suggested that both peptides induced osmotic disregulation. Treated bacteria manifested cytoplasmic swelling and extrusion of cytoplasmic contents through their peptidoglycan cell wall. The diverse array of antimicrobial peptides in S. clava hemocytes constitutes an effective host defense mechanism.

Styela clava is a cosmopolitan solitary tunicate ("sea squirt") whose tadpole-shaped larvae display a constellation of features (notochord, pharyngeal gill slits, dorsal tubular nervous system, and post-anal tail) that is characteristic of the Phylum Chordata. These attributes are obliterated when it undergoes metamorphosis into a sessile polypoid adult. Because T-cells and immunoglobulin-producing B cells first arose in cartilaginous fish (Bartl et al., 1997Go; Lee et al., 2000Go), tunicates—like other invertebrates—rely on their innate immune system for host defense. The ability of S. clava and other tunicates to thrive in microbe-laden waters suggests that they possess a robust innate immune system.

The importance of white blood corpuscles (leukocytes) in innate host defense was established by the investigations of Metchnikoff in the 19th century. In recent decades, much has been learned about the antimicrobial mechanisms of mammalian leukocytes. As background for our studies on tunicates, this work will be summarized briefly and very superficially. Mammalian phagocytes are of two general types, granulocytes and mononuclear phagocytes. The cytoplasmic "granules" of granulocytes are membrane bounded storage organelles that contain multiple peptides and proteins. Humans have four types of granulocytes. These were named over a century ago to reflect how their cytoplasm stained with aniline dyes. Three granulocyte types (neutrophils, eosinophils and basophils) circulate in the blood, and the fourth (mast cells) is restricted to tissues.

The cytoplasmic granules of human neutrophils (PMNs) are of several types. Azurophil (primary) granules contain large amounts of defensins, ~3.5 kDa cysteine-rich antimicrobial peptides (Lehrer et al., 1993Go). In addition, they contain several neutral proteases (elastase, cathepsin G and proteinase 3); a heme-containing enzyme called myeloperoxidase, lysozyme, and at least three antimicrobial proteins (azurocidin, B/PI and lysozyme). Although some of the contents of azurophil granules are released extracellularly when neutrophils (PMN) encounter microbes, most of their contents are discharged into phagocytic vacuoles formed when microbes are ingested. At least two additional types of cytoplasmic granules (secondary and tertiary) also exist in human PMNs. The secondary granules release their contents extracellularly in response to a variety of signals associated with the presence of microbes. In addition to lysozyme, the secondary granules of human PMNs also contain lactoferrin and the precursor of an alpha-helical peptide called LL-37 (Cowland et al., 1995Go).

Because of their abundance in blood and their importance in host defense, the microbicidal mechanisms of human PMNs have been examined closely. Mammalian PMNs use three general mechanisms to kill ingested microbes. The relative contributions of these mechanisms differ considerably from species to species. While one mechanism utilizes peptides and proteins, two of the mechanisms are oxidative in nature. One of these oxidative modes involves the assembly of a multi-component NADPH oxidase complex that reduces molecular oxygen univalently to superoxide (O2) anions (Nauseef, 1999Go; Babior, 1999Go). The other, which is mediated by an inducible, multi-component nitric oxide synthase (iNOS), is less prominent in human PMNs than the NADPH oxidase system (Murray and Nathan, 1999Go; Nathan and Shiloh, 2000Go). We are unaware of data concerning the presence or absence of NADPH oxidase and iNOS in tunicate hemocytes. Phenoloxidase, an enzyme that can generate H2O2, is present in the "morula cells" of Styela plicata (Cammarata et al., 1997Go) and of Botryllus schlosseri (Ballarin et al., 1998Go).

The superoxide anions generated by NADPH oxidase are unstable and undergo secondary reactions, including dismutation to hydrogen peroxide. H2O2 is more stable than superoxide and has modest antimicrobial properties, but it can be degraded rapidly by catalase, an enzyme found in erythrocytes and many bacteria. However, PMNs transform H2O2 into more potent oxidants in several ways, one of which involves myeloperoxidase. When provided with chloride and H2O2, myeloperoxidase catalyzes the formation of molecules indistinguishable from the hypochlorite found in Clorox bleach (Klebanoff, 1999Go). This nascent bleach can also react with primary or secondary amines to form longer lasting, antimicrobial chloramines (Weiss et al., 1983Go). In addition to its reactions with myeloperoxidase, H2O2 can interact with divalent iron in a Fenton reaction that generates hydroxyl radicals (Wardman and Candeis, 1996Go). The highly reactive hydroxyl radicals are potent microbicides.

In certain species, especially rodents, macrophages have an inducible nitric oxide synthase complex (iNOS) that can generate large amounts of nitric oxide—a strong oxidant with antimicrobial properties. In many rodent models, the ability to produce nitric oxide is critical in allowing macrophages to deal with diverse pathogens, organisms ranging from trypanosomes (Murray and Nathan, 1999Go) to mycobacteria (Bekker et al., 2001Go). Because macrophages lack storage pools of dedicated antimicrobial proteins and peptides, they may depend on NADPH oxidase and nitric oxide synthase more than PMNs or other granulocytes.

Although eosinophils have been studied mostly with respect to their activity against various helminths, their cytoplasmic granules contain at least three molecules that can also kill bacteria—eosinophil peroxidase, major basic protein and eosinophil cationic protein (Lehrer et al., 1989Go).

While the following caveat may not surprise any readers who have perused the voluminous older literature on tunicate hemocytes, there is no direct correspondence between the various white blood cell subtypes of tunicates and mammals. Indeed, using light and electron microscopy, we could identify six different subtypes of S. clava granulocytes rather than the four types known in humans. Moreover, when we examined the hemocytes of several other tunicates (e.g., Styela plicata, Styela montereyensis and Pyura spp.), we found decided differences among them. In our studies of S. clava cells, we generally made no effort to separate the various hemocyte subtypes. Instead, mixed hemocyte populations were harvested and extracted into acetic acid. These extracts were fractionated by gel chromatography, preparative electrophoresis and RP-HPLC. Peptide purification was monitored by gel overlay and radial diffusion assays to identify fractions with antimicrobial activity.

Figure 1 shows the sequences of the five clavanin peptides, Clavanins A-E, that we isolated from a mixed population of S. clava hemocytes (Lee et al., 1997aGo). Each peptide contained 23 amino acid residues, of which 18 (78.2%) were identical. Clavanins C and D contained a post-translationally modified tyrosine residue that we tentatively identified as methyl-tyrosine. However, given the findings on Styelin D described below, these could also be 3,4-dihydroxyphenylalanine (DOPA) residues instead. Each Clavanin peptide contained 4 or 5 phenylalanine residues. At neutral pH, their amidated C-terminus plus the presence of 1 or 2 arginines/lysines imparted a net charge +2 to +3, making them moderately cationic. At an acidic pH, protonation of their 3 or 4 histidines more than doubled this net charge and increased their antimicrobial potency (Lee et al., 1997cGo). CD spectrometry revealed that clavanins assumed an alpha-helical conformation in the membrane-like environments, such as were provided by phospholipid micelles or trifluoroethanol.



View larger version (24K):
[in this window]
[in a new window]
 
FIG. 1. Sequences of five S. clava Clavanins. aKey to symbols. Standard single letter code is used, except that Y denotes a modified tyrosine and * signifies amidation

 
We also cloned Clavanins A-E from a cDNA library that was prepared from the pharyngeal tissues of S. clava (Zhao et al., 1997aGo). The peptide precursors had a distinctive architecture, with a 19 residue signal sequence followed in turn by a 10-residue polar propiece, the peptide, and a 27 residue anionic C-terminal extension. The sequence (LEERKSEEEK) of the propiece was invariant and that of the 27 residue C-terminal extension was highly (96.3–100%) conserved. While performing cloning experiments, we found mRNA for the precursor of clavaspirin. This mRNA was highly homologous to proclavanins A-E except in the mature peptide domain (Fig. 2), where only 7/23 (30.4%) residues were identical. In contrast, the signal sequences, propieces and C-terminal extensions of these precursors were identical in 50/56 (89.3%) residues (Lee et al., 2001Go). This is reminiscent of the situation found in cathelicidins (Zanetti et al., 1995Go). In this structurally diverse group of antimicrobial peptides, all of the precursors contain a conserved "cathelin" pro-domain.



View larger version (17K):
[in this window]
[in a new window]
 
FIG. 2. Comparison of clavaspirin and clavanin A. The signal sequences, anionic propieces and C-terminal extensions of Clavanin A (ClavA) and Clavaspirin (Cvspn) are on top, and the sequences of the mature clavanin A and clavaspirin peptides are below. Identical residues are connected by a vertical line, similar residues are denoted by a +. In both mature peptides, the C-terminal glycine (G) is represented by an amide group

 
An anionic propiece exists in other antimicrobial peptides, including pleurocidin (discussed below), ranalexin and other frog peptides, and mammalian alpha defensins. It has been speculated that electrostatic interactions between the anionic pro-domains and the cationic antimicrobial domains may protect host cells from self-inflicted damage while moving the peptides from their synthesis sites to their storage organelles.

In addition to the five clavanins, we purified two larger antimicrobial peptides from S. clava hemocytes, Styelins A and B (Lee et al., 1997bGo). Although their post-translational modifications made sequencing difficult, we obtained enough data to design probes for screening the S. clava branchial cDNA library (Zhao et al., 1997bGo). In this manner, we cloned mRNAs for three prepropeptides that were designated Styelins C, D and E. They had identical 22 residue signal sequences and contained a 26 residue C-terminal anionic domain in which 21/26 (80.8%) residues were identical. Their 31 or 32 residue peptide domains resided proximal to the C-terminal propiece. The peptide domains of Styelins A, B and C were identical in at least 17/20 (85%) N-terminal residues. Styelins D and E were identical to each other in 80/81 residues (98.8%), differing only in position 25, which was a lysine in Styelin D and a glutamine in Styelin E.

Styelin D was remarkable in containing 12 post-translationally modified residues (Taylor et al., 2000Go). These included a 6-bromotryptophan, two monohydroxylysines, four 3,4-dihydroxyphenylalanines (DOPA), four dihydroxylysines and one dihydroxyar-ginine. Its sequence was: GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL-NH(2), where W is 6-bromotryptophan, R is dihydroxyarginine, Y is 3,4-dihydroxyphenylalanine (DOPA), K is 5-hydroxylysine, and K is dihydroxylysine. These modifications enhanced Styelin D's bactericidal ability at acidic pH and high salinity. The presence of multiple hydroxylated residues in Styelins could impart other properties to them. Among these, are an ability a) to bind metals, b) participate in processes that generate free radicals, and c) form multiple pro-adhesive hydrogen bonds. All of these possibilities are attractive subjects for future research.

In an earlier report on Styelins, we commented on an apparent sequence homology between the precursors of styelins and cecropins (Zhao et al., 1997bGo). Cecropins are a family of alpha helical peptides found in diptera (e.g., flies, mosquitoes, lepidoptera, etc.). In a more recent data base search, we found a possible homologue of Styelins in a vertebrate—the winter flounder, Pseudopleuronectes americanus. In Figure 3 the sequence of Styelin D is aligned with that of Pleurocidin. The program (Blast 2.2) has inserted three gaps with a total of eight residues to maximize alignment. Overall, 19/62 residues (30%) are identical and 32/62 (51.6%) are either identical or conservatively replaced. To continue our "fishing expedition," we also searched for any antimicrobial peptides with a signal sequence that resembled Styelin D's. This exercise was not necessarily frivolous, because the signal sequences of some antimicrobial peptides (e.g., defensins (Zhao et al., 2001) and frog skin peptides (Clark et al., 1994Go; Amiche et al., 1994Go) can be more highly conserved than the associated peptides. As shown in Figure 3, two antimicrobial peptides met our search profile: attacin A from the fruit fly Drosophila melanogaster, and myticin C from the mussel, Mytilis galloprovincialis. The signal sequences of attacin A and Styelins C-E were identical in 15/23 (65.2%) residues and similar in 17/23 (73.9%). The signal sequence of myticin C was identical to Styelins C-E in 11/14 residues (78.6%) and similar in 13/14 (92.9%). Although such resemblance could have arisen by chance, they may represent traces of exon shuffling in the evolutionary histories of these peptides.



View larger version (32K):
[in this window]
[in a new window]
 
FIG. 3. Possible Homologues of Styelins. A data base search performed on the signal sequence and mature peptide of Styelin C retrieved several antimicrobial peptides. These included numerous cecropins, including cecropin 1 (AF416602 [GenBank] ) of the housefly, Musca domestica and pleurocidin (AF301512 [GenBank] ), an alpha-helical peptide of the flounder, Pseudopleuronectes americanus. A search done only on the styelin signal sequence retrieved the signal peptides of two additional antimicrobial peptides: attacin A (AF220544 [GenBank] ) of the fruitfly, Drosophila melanogaster, and myticin A (AF162334 [GenBank] ) of the mussel, Mytilus galloprovincialis

 
Which hemocytes of S. clava contain clavanins and styelins? The main panel of Figure 4 shows a mixed population of hemocytes that had been gently centrifuged onto a glass slide, fixed, and stained with Mallory's trichrome—a mixture of orange G, methyl blue and acid fuchsin. Three general types of cells can be seen. About half of them are eosinophilic granulocytes (G), cells with multiple red-stained cytoplasmic granules. The remainder are mostly macrophages (M) (relatively large cells whose cytoplasm appears devoid of granules) and small cells (L) that superficially resemble lymphocytes. The inset displays two granulocytes that were stained with a mixture of orange G and methyl blue. These cells adhered to the slide spontaneously under unit gravity, rather than being centrifuged onto it, and have a more "life-like" appearance. One of these granulocytes has a trailing "uropod" (arrow), a cytoplasmic protrusion opposite to its direction of motion. The cytoplasmic granules of both cells are oval-shaped, uniform in size and distinctly orange. These features exemplify the Type 5 granulocyte shown in Figure 5 and described below.



View larger version (104K):
[in this window]
[in a new window]
 
FIG. 4. Morphology of S. clava hemocytes. The large panel on the left was stained with Mallory's trichrome stain. The small inset shows two adherent granulocytes stained with a mixture of methyl blue and orange G. The rightmost panel shows an alkaline nitroblue tetrazolium stain that detects redox-active residues, such as DOPA (dihydroxyphenylalanine) and TOPA (trihydroxyphenylalanine). Abbreviations: G, granulocyte; M, macrophage, L, lymphocyte-like cell, U, uropod. The arrow shows a granulocyte within a macrophage

 


View larger version (50K):
[in this window]
[in a new window]
 
FIG. 5. Characteristics of five granulocyte subtypes in S. clava. Type 1, 2 and 3 granulocytes were previously described (Sawada et al., 1993Go). Types 4 and 5 granulocytes are also eosinophilic, but their granules differ distinctly from the type 2 and 3 granules. Type 1 granulocytes are also called basophils. A full report of this study will appear elsewhere (Menzel et al., 2002Go)

 
Close to the bottom of the panel, one macrophage contains a granulocyte (arrow) that it may have just ingested. In other fields, we noted occasional macrophages with orange-staining cytoplasm, perhaps the residue from some earlier feast of this nature. Electron microscopy allowed us to examine the cytoplasmic granules of S. clava hemocytes more closely. We observed six distinct granulocyte subsets, three of which (Types 1, 2 and 3) had earlier been defined (Sawada et al., 1993Go). Information about five of these six granulocyte subsets is shown in Figure 5. Immunocytochemical studies revealed clavanins in the cytoplasmic granules of Type 2–5 eosinophilic granulocytes, as well as in the cytoplasm of macrophages and the large spherical vacuoles of Type 6 granulocytes (Menzel et al., 2002Go). These Type 6 cells may correspond to the "morula cells" described by other investigators. Styelins and clavanins were very abundant, and constituted at least 10–20% of the total extractable protein in our crude starting extracts. They may be largely responsible for the eosinophilic staining of the granules that contain them.

It is known that DOPA residues react with nitro-blue tetrazolium (NBT) under alkaline conditions to produce an insoluble blue formazan dye (Taylor et al., 1995Go, 1997Go). Since Styelin D has 4 DOPA residues, we used this reaction as a histochemical test to determine which hemocyte types contained DOPA-rich peptides (Fig. 4, right panel). Neither the macrophages nor the small lymphocyte-like cells were stained by alkaline NBT. In contrast, most granulocytes were rendered distinctly blue. We consider this presumptive evidence that styelins are components of granulocytes rather than macrophages.

How do clavanins and styelins kill bacteria? Electron micrographs of treated Escherichia coli and Staphylococci provide useful clues. Figure 6 shows four scanning electron micrographs of E. coli cells that were exposed to 50 µg/ml of Styelin D (Panels A, B) or clavaspirin (Panels C, D) for 30 or 60 minutes. Many bacteria have extruded their cytoplasm beyond the confines of the cell wall (arrows) and the outer membrane of bacteria treated with Styelin D has a cobblestone appearance quite different from the relatively normal appearance of the surface of clavaspirin-treated bacteria.



View larger version (125K):
[in this window]
[in a new window]
 
FIG. 6. Scanning electron micrographs. E. coli ML-35p was treated at room temperature for 30 minutes with 50 µg/ml of Styelin D (StyD, panels A, B) or 50 µg/ml of clavaspirin (cspn, panels C, D). The arrows point to cytoplasmic extrusions. The Styelin-treated organisms have a bumpy surface, while the clavaspirin-treated cells are smooth

 
Figure 7 shows transmission electron micrographs of E. coli treated with Styelin D. Panel A shows untreated controls. Panel B shows Styelin-treated cells and is printed as a negative. The heavy arrowheads call attention to the outer membrane, which is thrown into multiple small folds, and the fine arrows point to areas of cytoplasmic rarefaction. Panel C is a conventional positive print of Styelin-treated bacteria. The cells appear swollen and contain areas of cytoplasmic rarefaction (loss of electron density). One cell appears to have extruded some of its cytoplasm beyond the cell wall, consistent with findings in the scanning micrographs. In Panel D, a later stage, a fine arrow points to an area of extruded cytoplasm. Note that two cells near the bottom have lost most of their cytoplasmic contents. Although its antimicrobial mechanism requires additional study, the appearance of styelin-treated organisms is reminiscent of protegrin-treated bacteria.



View larger version (116K):
[in this window]
[in a new window]
 
FIG. 7. Effects of Styelin D on E. coli ML-35p. Panel A shows untreated E. coli controls. Panel B (a negative image) shows E. coli exposed to 50 µg/ml of Styelin D for 15 minutes. The fine arrows indicate areas of cytoplasmic rarefaction (loss of electron density) and the larger arrowheads point to the outer membrane, which has expanded and displays multiple small folds. Panel C (a positive print) shows other organisms treated with Styelin D for 15 min. The large arrows call attention to the multiple small outer membrane folds. Cytoplasmic rarefaction is present in most bacteria and one organism shows transmural cytoplasmic extrusion. Panel D, taken after 30 minutes of exposure, shows two largely empty bacteria with little residual cytoplasmic content. The arrow points to an area of extruded cytoplasm

 
Protegrin-treated bacteria sustain a rapid influx of water that triggers a massive efflux of potassium. The water influx is driven by osmotic forces and causes the bacteria to swell. This swelling induces secondary membrane permeability changes and can extrude portions of the cytoplasmic membrane through small openings (tesserae) in the peptidoglycan. Extruded cytoplasmic protrusions are osmotically fragile and easily ruptured. This overall mechanism was named "hydro-osmotic trans-tesseral extrusion and rupture" and given the acronym "HOTTER." (Orlov et al., 2002Go).

In contrast to the membrane ruffling found with Styelin D treated E. coli, those treated with clavaspirin show only modest swelling in Figure 8. The inset of an area enlarged further shows a fuzzy outer membrane, likely due to the sectioning angle, and small deposits of electron dense material noted by the small arrows. On similar spots, lead and uranium were determined responsible for the electron density suggesting that clavaspirin may have an affinity for these heavy metals.



View larger version (173K):
[in this window]
[in a new window]
 
FIG. 8. Effects of Clavaspirin on E. coli ML-35p. These thin sections were viewed by transmission electron microscopy. The organisms had been treated with 50 µg/ml of clavaspirin and were nonviable. Their outer membranes were smooth, and organisms with extruded cytoplasm (ec) were rare. The inset shows a 3x enlargement of the area in the white box. The white arrow points to surface fuzz, which was seen on some cells and the black arrows point to small electron-dense precipitates which contained lead and uranium when analyzed by electron dispersive spectroscopy

 
Staphylococci are affected similarly by these peptides. Styelin D has caused many of these cells shown in the scanning electron micrographs of Figure 9 panels A and B to extrude parts of their cytoplasm. Different stages are illustrated in the two panels, 15 minutes and 60 minutes of exposure in A and B respectively. Panels C and D show that the morphological effects of clavaspirin on staphylococci are nearly identical to the Styelin D treated ones. That these peptides act rapidly is illustrated in Panel A, which shows representative staphylococci after 5 minutes of exposure to 50 µg/ml of clavaspirin.



View larger version (128K):
[in this window]
[in a new window]
 
FIG. 9. Scanning electron micrographs. A methicillin-resistant strain of Staphylococcus aureus (MRSA ATCC 33591) was treated with 50 µg/ml of Styelin D (Panels A, B) or 50 µg/ml of clavaspirin (Panels C, D). Incubation times are noted on each panel. The arrows point to cytoplasmic extrusions

 
Figure 10 illustrates two of the three ways by which S. clava can engage bacteria; by delivery to phagocytic vacuoles or following discharge at the hemocyte's membrane. The third way (secretion into the animal's hemolymph) does not lend itself to illustration by electron microscopy. Panel A of Figure 10 shows a phagocytic Type 3 granulocyte (recognized by its characteristic granules) whose cytoplasmic vacuole (vac) contains an ingested marine bacterium, Psychrobacter immobilis (p), and the debris of a second organism (arrow). Panel B shows two Psychrobacter cells attached to the surface of another hemocyte by a myriad of filamentous ties. Two of the hemocyte's granules (g) can be seen adjacent to plasma membrane and the lower organism. Near these granules are several vesicular structures that could represent granules that have discharged their contents. The outer membranes of both bacteria show multiple tiny folds (arrowhead), resembling those noted in styelin-treated E. coli (Fig. 7).



View larger version (139K):
[in this window]
[in a new window]
 
FIG. 10. S. clava hemocytes and Psychrobacter immobilis. Panel A, shows Psychrobacter immobilis (P), a Gram-negative marine bacterium, within a phagocytic vacuole (vac) that also contains some bacterial fragments (arrow). This hemocyte's granules have an electron-dense core (c) and an electron-lucent sheath (s). Panel B shows two Psychrobacter immobilis bound to the membrane of another hemocyte. Only a few cytoplasmic granules (g) remain visible inside the hemocyte, whose cytoplasm contains multiple small vesicles. The fine arrows point to zones of adherence, and the large arrowhead to the extensively folded bacterial outer membrane

 
Are there potential uses for antimicrobial peptides from tunicates? There could be many, both for the environment (as "green" anti-pollutants and microbicides) and in medical practice. The introduction of antibiotics was perhaps the major medical advance of the twentieth century. However, in recent years many bacteria have become resistant to conventional antibiotics and there is an urgent need for new antimicrobial agents (Hancock and Lehrer, 1998Go). Although most antibiotics are secondary metabolites of fungi, streptomycetes or bacteria, a few are peptides (e.g., nisin and other lantibiotics), lipopeptides (e.g., polymyxin B) or glycopeptides (e.g., vancomycin or teichoplanins). In general, peptide antibiotics have different mechanisms and targets than the antibiotics now in medical use. Consequently, many are highly effective against resistant organisms, including Pseudomonas aeruginosa and methicillin-resistant S. aureus. Technologies exist to produce peptides by recombinant or direct synthesis, and they are likely to improve in the future. Tunicates and their hemocytes, peptides and depsipeptides provide an accessible, renewable resource that could reward wider exploration.


    ACKNOWLEDGMENTS
 
We thank Birgitta Sjostrand for her expertise and assistance with electron microscopy. Our work on tunicate peptides was supported, in part, by the National Sea Grant College Program of the U.S. Department of Commerce's National Oceanic and Atmospheric Administration under a NOAA Grant: project number R/MP-93 through the California Sea Grant College Program. The views expressed herein do not necessarily reflect the views of any of these organizations.


    FOOTNOTES
 
1 From the Symposium Comparative Immunology presented at the Annual Meeting of the Society for Integrative and Comparative Biology, 2–6 January 20002, at Anaheim, California. Back

2 E-mail: rlehrer{at}mednet.ucla.edu Back


    References
 TOP
 SYNOPSIS
 References
 
Amiche, M., F. Ducancel, A. Mor, J. C. Boulain, A. Menez, and P. Nicolas. 1994. Precursors of vertebrate peptide antibiotics dermaseptin b and adenoregulin have extensive sequence identities with precursors of opioid peptides dermorphin, dermenkephalin, and deltorphins. J. Biol. Chem, 269:17847-17852.[Abstract/Free Full Text]

Babior, B. M. 1999. NADPH oxidase: An update. Blood, 93:1464-1476.[Free Full Text]

Ballarin, L., F. Cima, and A. Sabbadin. 1998. Phenoloxidase and cytotoxicity in the compound ascidian Botryllus schlosseri. Dev. Comp. Immunol, 22:479-492.[CrossRef][Web of Science][Medline]

Bartl, S., M. A. Baish, M. F. Flajnik, and Y. Ohta. 1997. Identification of class I genes in cartilaginous fish, the most ancient group of vertebrates displaying an adaptive immune response. J. Immunol, 159:6097-6104.[Abstract]

Bekker, L. G., S. Freeman, P. J. Murray, B. Ryffel, and G. Kaplan. 2001. TNF-alpha controls intracellular mycobacterial growth by both inducible nitric oxide synthase-dependent and inducible nitric oxide synthase- independent pathways. J. Immunol, 166:6728-6734.[Abstract/Free Full Text]

Cammarata, M., V. Arizza, N. Parrinello, G. Candore, and C. Caruso. 1997. Phenoloxidase-dependent cytotoxic mechanism in ascidian (Styela plicata) hemocytes active against erythrocytes and K562 tumor cells. Eur. J. Cell Biol, 74:302-307.[Web of Science][Medline]

Clark, D. P., S. Durell, W. L. Maloy, and M. Zasloff. 1994. Ranalexin. A novel antimicrobial peptide from bullfrog (Rana catesbeiana) skin, structurally related to the bacterial antibiotic, polymyxin. J. Biol. Chem, 269:10849-10855.[Abstract/Free Full Text]

Cowland, J. B., A. H. Johnsen, and N. Borregaard. 1995. hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules. FEBS Lett, 368:173-176.[CrossRef][Web of Science][Medline]

Hancock, R. E., and R. I. Lehrer. 1998. Cationic peptides: A new source of antibiotics. Trends Biotechnol, 16:82-88.[CrossRef][Web of Science][Medline]

Klebanoff, S. J. 1999. Myeloperoxidase. Proc. Assoc. Am. Physicians, 111:383-389.[Web of Science][Medline]

Lee, I. H., C. Zhao, Y. Cho, S. S. Harwig, E. L. Cooper, and R. I. Lehrer. 1997a. Clavanins, alpha-helical antimicrobial peptides from tunicate hemocytes. FEBS Lett, 400:158-162.[CrossRef][Web of Science][Medline]

Lee, I. H., Y. Cho, and R. I. Lehrer. 1997b. Styelins, broad-spectrum antimicrobial peptides from the solitary tunicate, Styela clava. Comp. Biochem. Physiol. B Biochem. Mol. Biol, 118:515-521.[CrossRef][Medline]

Lee, I. H., Y. Cho, and R. I. Lehrer. 1997c. Effects of pH and Salinity on the Antimicrobial Properties of Clavanins. Infect. Immun, 65:2898-2903.[Abstract]

Lee, I. H., C. Zhao, T. Nguyen, L. Menzel, A. J. Waring, M. A. Sherman, and R. I. Lehrer. 2001. Clavaspirin, an antibacterial and haemolytic peptide from Styela clava. J. Peptide Res, 58:445-456.[CrossRef][Medline]

Lee, S. S., D. Fitch, M. F. Flajnik, and E. Hsu. 2000. Rearrangement of immunoglobulin genes in shark germ cells. J. Exp. Med, 191:1637-1648.[Abstract/Free Full Text]

Lehrer, R. I., A. K. Lichtenstein, and T. Ganz. 1993. Defensins: antimicrobial and cytotoxic peptides of mammalian cells. Annu. Rev. Immunol, 11:105-128.[CrossRef][Web of Science][Medline]

Lehrer, R. I., D. Szklarek, A. Barton, T. Ganz, K. J. Hamann, and G. J. Gleich. 1989. Antibacterial properties of eosinophil major basic protein and eosinophil cationic protein. J. Immunol, 142:4428-4434.[Abstract]

Menzel, L. P., I. H. Lee, B. Sjostrand, and R. I. Lehrer. 2002. Immunolocalization of clavanins in Styela clava hemocytes. Dev. Comp. Immunol, 26:505-515.[CrossRef][Web of Science][Medline]

Murray, H. W., and C. F. Nathan. 1999. Macrophage microbicidal mechanisms in vivo: Reactive nitrogen versus oxygen intermediates in the killing of intracellular visceral Leishmania donovani. J. Exp. Med, 189:741-746.[Abstract/Free Full Text]

Nathan, C., and M. U. Shiloh. 2000. Reactive oxygen and nitrogen intermediates in the relationship between mammalian hosts and microbial pathogens. Proc. Natl. Acad. Sci. U.S.A, 97:8841-8848.[Abstract/Free Full Text]

Nauseef, W. M. 1999. The NADPH-dependent oxidase of phagocytes. Proc. Assoc. Am. Physicians, 111:373-382.[Web of Science][Medline]

Orlov, D., T. Hong, L. P. Menzel, R. Azimov, T. J. Falla, A. J. Waring, and R. I. Lehrer. 2002. Bactericidal Mechanism of Iseganan (IB-367), a Rapidly Acting Antimicrobial Protegrin Peptide. Abstracts of the 41st Annual Interscience Conference on Antimicrobial Agents and Chemotherapy. Abstract C1-1805, page 99.

Sawada, T., J. Zhang, and E. L. Cooper. 1993. Classification and characterization of hemocytes in Styela Clava. Biol. Bull, 184:84-96.

Taylor, S. W., A. G. Craig, W. H. Fischer, M. Park, and R. I. Lehrer. 2000. Styelin D, an extensively modified antimicrobial peptide from ascidian hemocytes. J. Biol. Chem, 275:38417-38426.[Abstract/Free Full Text]

Taylor, S. W., B. Kammerer, G. J. Nicholson, K. Pusecker, T. Walk, E. Bayer, S. Scippa, and M. de Vincentiis. 1997. Morulin Pm: a modified polypeptide containing TOPA and 6-bromotryptophan from the morula cells of the ascidian, Phallusia mammillata. Arch. Biochem. Biophys, 348:278-288.[CrossRef][Medline]

Taylor, S. W., M. M. Ross, and J. H. Waite. 1995. Novel 3,4-di- and 3,4,5-trihydroxyphenylalanine-containing polypeptides from the blood cells of the ascidians Ascidia ceratodes and Molgula manhattensis. Arch. Biochem. Biophys, 324:228-240.[Medline]

Wardman, P., and L. P. Candeias. 1996. Fenton chemistry: An introduction. Radiat. Res, 145:523-531.[Web of Science][Medline]

Weiss, S. J., M. B. Lampert, and S. T. Test. 1983. Long-lived oxidants generated by human neutrophils: Characterization and bioactivity. Science, 222:625-628.[Abstract/Free Full Text]

Zanetti, M., R. Gennaro, and D. Romeo. 1995. Cathelicidins: A novel protein family with a common proregion and a variable C-terminal antimicrobial domain. FEBS Lett, 374:1-5.[CrossRef][Web of Science][Medline]

Zhao, C., L. Liaw, I. H. Lee, and R. I. Lehrer. 1997a. cDNA cloning of Clavanins: Antimicrobial peptides of tunicate hemocytes. FEBS Lett, 410:490-492.[Medline]

Zhao, C., L. Liaw, I. H. Lee, and R. I. Lehrer. 1997b. cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava. FEBS Lett, 412:144-148.[CrossRef][Web of Science][Medline]

Zhao, C., T. Nguyen, L. Liu, R. E. Sacco, K. A. Brogden, and R. I. Lehrer. 2001. Gallinacin-3, an inducible epithelial beta-defensin in the chicken. Infect. Immun, 69:2684-2691.[Abstract/Free Full Text]


Add to CiteULike CiteULike   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us    What's this?



This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Search for citing articles in:
ISI Web of Science (3)
Right arrow Request Permissions
Google Scholar
Right arrow Articles by Lehrer, R. I.
Right arrow Articles by Waring, A. J.
Right arrow Search for Related Content
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?